Products

IL-15 (Interleukin-15), Swine

Interleukin-15 (IL-15) is a cytokine with structural similarity to Interleukin-2 (IL-2). Like IL-2, IL-15 binds to and signals through a complex composed of IL-2/IL-15 receptor beta chain (CD122) and the common gamma chain (gamma-C, CD132). IL-15 is secreted by mononuclear phagocytes (and some other cells) following infection by virus(es). This cytokine induces cell proliferation of natural killer cells; cells of the innate immune system whose principal role is to kill virally infected cells.
No. Size Price Qty Status
C03008-5UG 5 ug $120.00 Inquiry
C03008-20UG 20 ug $300.00 Inquiry
C03008-100UG 100 ug $594.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
TWQHVISDLKKIEDLIRSIHMDATLYTESDAHPNCKVTAMKCFLLELRVILQESRNSDISDTVENLIILANSSLSSIEYKTESGCKECEELEEKNINE
FLKSFIHIVQMFINPS with polyhistidine tag at the N-terminus

UnitProt ID:
Q95253
 
Source:
Escherichia coli

Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method.

Activity:
Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is <5.5 ng/mL.
 
Purity:
>95% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping conditions:
Blue ice
Reviews for IL-15 (Interleukin-15), Swine

Average Rating: 0 (0 Reviews )